PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa08g002400.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HB-other
Protein Properties Length: 365aa    MW: 40616.7 Da    PI: 4.42
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa08g002400.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.21.4e-08302349653
                     S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
        Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                     + +k  +e+Le+++++++ p+ +    + + ++L+ ++V  WF  +Ra
  Csa08g002400.1 302 RVKKAHIETLEKVYRRSKRPTNAVVSSIVQVTNLPRKRVLKWFEDKRA 349
                     567899*****************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.669294354IPR001356Homeobox domain
SuperFamilySSF466896.42E-8299354IPR009057Homeodomain-like
SMARTSM003897.8E-4300358IPR001356Homeobox domain
PfamPF000464.8E-6302349IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.7E-7302360IPR009057Homeodomain-like
CDDcd000861.87E-5305349No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MAVALSSSSG VVSHLLPPSF SSSSRVSVNR VLFRNRKSSP CSLSLPFHSP SLRSVLVFAR  60
GKNRKGFASS SSPSPKKNKK KSFERDDNGE SEEEDDPFEA LFNLLEEDLK NDNSSIDDEE  120
ISEEELNALA DELARVLGGG DDDDDGIDLF GSATGDVVDD KDENEDEDDN NDDEDDEDEN  180
DDDSEEEDER PSKLKNWQLR RLAYALKAGR RKTSIKNLAA EVCLDRAYVL ELLRDPPPKL  240
LMLSATLPDE KPPVAAPENS SPDPTPVESS SAEEEDVVVE PVEKVKDEAV HVMQQRWSAQ  300
KRVKKAHIET LEKVYRRSKR PTNAVVSSIV QVTNLPRKRV LKWFEDKRAE DGVPDKRAPY  360
QAPV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0020170.0BT002017.1 Arabidopsis thaliana putative protein (At5g11270) mRNA, complete cds.
GenBankBT0087430.0BT008743.1 Arabidopsis thaliana At5g11270 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010419685.10.0PREDICTED: protein BFR2-like
SwissprotQ8H0V51e-160OCP3_ARATH; Protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3
TrEMBLD7M3N91e-175D7M3N9_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.6__1093__AT5G11270.11e-175(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM120772631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11270.11e-119overexpressor of cationic peroxidase 3